PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004490086.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 374aa    MW: 42336.3 Da    PI: 7.0348
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004490086.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF64.79.7e-211862145
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    kr en+  rq t++kR+ngi+KKA+ELS+LCd+++ +++fs+ gk
  XP_004490086.1 18 KRLENTNGRQATYAKRKNGIMKKASELSILCDIDIILLMFSPGGK 62
                    689**************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.5771062IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-271069IPR002100Transcription factor, MADS-box
CDDcd001207.79E-251163No hitNo description
SuperFamilySSF554552.62E-2411104IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-161232IPR002100Transcription factor, MADS-box
PfamPF003191.9E-182063IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-163247IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-164768IPR002100Transcription factor, MADS-box
PROSITE profilePS512977.048116209IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MFESSINPTM GRVKLKIKRL ENTNGRQATY AKRKNGIMKK ASELSILCDI DIILLMFSPG  60
GKPSLCRGRR SNFEEVIAKF AQLTSQERAK RKLESLEALK KTFKKLDHDV NIQEFYGTSS  120
QTVEDLSNQT KLLHNRIAEI QERLSHWTEI EKISSVDELE HMENSLKESL NQINSHKENV  180
QKQQLASLQC NNQFNEMHVP YKMSAQQHLQ SISWMVNGDN QNIVMPEDSN LLLHKDVEGS  240
TSSSFGSYAS YLGSSTKTNN ISNSGQENCV LSDMSNTAPV RLQFNGQFPY IPNNFNIMND  300
VKLQPTTGIN NNNPHENQVD YNVNGNINEA PKQGFDQSNH HGWSSASGPC AVNIFDEHLY  360
HAQPNFPQVH FGFT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S6e-1310101190Myocyte-specific enhancer factor 2B
1tqe_R6e-1310101190Myocyte-specific enhancer factor 2B
1tqe_Q6e-1310101190Myocyte-specific enhancer factor 2B
1tqe_P6e-1310101190Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004490086.10.0PREDICTED: agamous-like MADS-box protein AGL8 homolog
SwissprotQ1PFA42e-95AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLG7KGN70.0G7KGN7_MEDTR; MADS-box transcription factor family protein
STRINGGLYMA07G35610.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27503370
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.22e-74AGAMOUS-like 30